PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010906724.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 318aa    MW: 35110.4 Da    PI: 7.6561
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010906724.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM128.84.1e-405514933128
             NAM  33 vikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                     ++ +vd++k+ePwdLp+++    kewyfFs rd+kyatg+r+nrat+sgyWkatgkd+ v + kg lvg++ktLvfy+grapkg+kt+Wvmhe+r
  XP_010906724.1  55 MMVDVDLNKCEPWDLPEMACVAGKEWYFFSLRDRKYATGQRTNRATSSGYWKATGKDRLVAR-KGVLVGMRKTLVFYQGRAPKGKKTEWVMHEFR 148
                     5889************76666889************************************99.999****************************9 PP

             NAM 128 l 128
                     +
  XP_010906724.1 149 M 149
                     8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100542.49821172IPR003441NAC domain
SuperFamilySSF1019411.44E-4854172IPR003441NAC domain
PfamPF023653.0E-1666149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MVVVSPLLSC CGARIDLGEI VTIMNDVMTT DRPKQLPSLR QVTGDCSGSF WGSPMMVDVD  60
LNKCEPWDLP EMACVAGKEW YFFSLRDRKY ATGQRTNRAT SSGYWKATGK DRLVARKGVL  120
VGMRKTLVFY QGRAPKGKKT EWVMHEFRME GPGDLTKLSF KGDWVLCRVF YKHRGFSTKP  180
SMETSYDDTG SSSLPSLMDT YITIDQTPQN LEGFEQVPCF SSFPPSHTSQ PPATLAPHLP  240
LVEGSLPLTK GLAQLGALPE LSSCLNPLSS DRNVIKAVLN QLTKLEGNPM GEVPPTLVDG  300
SLWGCFPETG LPSSWNPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-395517348166NO APICAL MERISTEM PROTEIN
1ut4_B4e-395517348166NO APICAL MERISTEM PROTEIN
1ut7_A4e-395517348166NO APICAL MERISTEM PROTEIN
1ut7_B4e-395517348166NO APICAL MERISTEM PROTEIN
3swm_A4e-395517351169NAC domain-containing protein 19
3swm_B4e-395517351169NAC domain-containing protein 19
3swm_C4e-395517351169NAC domain-containing protein 19
3swm_D4e-395517351169NAC domain-containing protein 19
3swp_A4e-395517351169NAC domain-containing protein 19
3swp_B4e-395517351169NAC domain-containing protein 19
3swp_C4e-395517351169NAC domain-containing protein 19
3swp_D4e-395517351169NAC domain-containing protein 19
4dul_A4e-395517348166NAC domain-containing protein 19
4dul_B4e-395517348166NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010906724.10.0PREDICTED: NAC domain-containing protein 21/22-like
SwissprotQ84TE69e-80NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLM0U3M11e-130M0U3M1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P26140_0011e-130(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP101237138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.25e-81NAC domain containing protein 1